CAMK2D

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA026281

 

Antibody HPA051783

 

Antibody HPA051785

 

Antibody HPA053973

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA026281 HPA051783 HPA051785 HPA053973 

Host species

Rabbit Rabbit Rabbit Rabbit 

Clonality

pAb pAb pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

5 12 12 12 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Recombinant protein fragment Recombinant protein fragment 

Length (aa)

60 26 27 33 

Antigen sequence

MDGSGMPKTMQSEETRVWHRRDGKWQNVHFHRSGSPTVPIKPPCIPNGKE
NFSGGTSLWQ
 
ELFEDIVAREYYSEADASHCIQQILE
 
LYQQIKAGAYDFPSPEWDTVTPEAKDL
 
GQEYAAKIINTKKLSARDHQKLEREARICRLLK
 

Matching transcripts

CAMK2D-003 - ENSP00000339740 [100%]
CAMK2D-008 - ENSP00000425824 [100%]
CAMK2D-009 - ENSP00000423482 [100%]
CAMK2D-012 - ENSP00000423677 [100%]
CAMK2D-202 - ENSP00000378034 [100%]
CAMK2D-203 - ENSP00000406131 [100%]
CAMK2D-204 - ENSP00000415707 [100%]
CAMK2D-205 - ENSP00000415248 [100%]
 CAMK2D-001 - ENSP00000378032 [100%]
CAMK2D-002 - ENSP00000369098 [100%]
CAMK2D-003 - ENSP00000339740 [100%]
CAMK2D-004 - ENSP00000378030 [100%]
CAMK2D-005 - ENSP00000424245 [100%]
CAMK2D-006 - ENSP00000422566 [100%]
CAMK2D-008 - ENSP00000425824 [100%]
CAMK2D-009 - ENSP00000423482 [100%]
CAMK2D-012 - ENSP00000423677 [100%]
CAMK2D-201 - ENSP00000296402 [100%]
CAMK2D-202 - ENSP00000378034 [100%]
CAMK2D-203 - ENSP00000406131 [100%]
CAMK2D-204 - ENSP00000415707 [100%]
CAMK2D-205 - ENSP00000415248 [100%]
 CAMK2D-001 - ENSP00000378032 [100%]
CAMK2D-002 - ENSP00000369098 [100%]
CAMK2D-003 - ENSP00000339740 [100%]
CAMK2D-004 - ENSP00000378030 [100%]
CAMK2D-005 - ENSP00000424245 [100%]
CAMK2D-006 - ENSP00000422566 [100%]
CAMK2D-008 - ENSP00000425824 [100%]
CAMK2D-009 - ENSP00000423482 [100%]
CAMK2D-012 - ENSP00000423677 [100%]
CAMK2D-016 - ENSP00000423753 [100%]
CAMK2D-201 - ENSP00000296402 [100%]
CAMK2D-202 - ENSP00000378034 [100%]
CAMK2D-203 - ENSP00000406131 [100%]
CAMK2D-204 - ENSP00000415707 [100%]
CAMK2D-205 - ENSP00000415248 [100%]
 CAMK2D-001 - ENSP00000378032 [100%]
CAMK2D-002 - ENSP00000369098 [100%]
CAMK2D-003 - ENSP00000339740 [100%]
CAMK2D-004 - ENSP00000378030 [100%]
CAMK2D-005 - ENSP00000424245 [100%]
CAMK2D-006 - ENSP00000422566 [100%]
CAMK2D-008 - ENSP00000425824 [100%]
CAMK2D-009 - ENSP00000423482 [100%]
CAMK2D-012 - ENSP00000423677 [100%]
CAMK2D-201 - ENSP00000296402 [100%]
CAMK2D-202 - ENSP00000378034 [100%]
CAMK2D-203 - ENSP00000406131 [100%]
CAMK2D-204 - ENSP00000415707 [100%]
CAMK2D-205 - ENSP00000415248 [100%]
 

Other gene match

 CAMK2B - ENSG00000058404 [100%]
CAMK2A - ENSG00000070808 [100%]
CAMK2G - ENSG00000148660 [96%]
 CAMK2B - ENSG00000058404 [96%]
CAMK2A - ENSG00000070808 [100%]
CAMK2G - ENSG00000148660 [96%]
 CAMK2B - ENSG00000058404 [97%]
CAMK2A - ENSG00000070808 [100%]
CAMK2G - ENSG00000148660 [97%]
 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

    

Description

Immunohistochemical staining of human heart muscle shows moderate cytoplasmic and nuclear positivity in myocytes.
More information
 Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.
More information
 Immunohistochemical staining of human hippocampus shows moderate positivity in subsets of neuronal cells.
More information
 Immunohistochemical staining of human hippocampus shows strong cytoplasmic positivity in neuronal cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:25 1:275 1:10 1:175 

Literature conformity

Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data Partly consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data 

RNA consistency

Not done Not done Not done Not done 

         Western Blot

Image

    

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

60.0, 59.2, 58.5, 57.9, 57.6, 56.4, 56.3 72.7, 65.2, 62.2, 60.4, 60.0, 59.8, 59.6, 59.2, 59.0, 58.5, 58.0, 57.9, 57.8, 57.6, 56.4, 56.3, 56.0, 55.7, 55.4, 55.3, 55.2, 54.1, 51.0, 50.9, 41.1, 20.5, 19.6 72.7, 65.2, 62.2, 60.4, 60.0, 59.8, 59.6, 59.2, 59.0, 58.5, 58.0, 57.9, 57.8, 57.6, 56.4, 56.3, 56.0, 55.7, 55.4, 55.3, 55.2, 54.1, 51.0, 50.9, 41.1, 36.9, 33.3, 22.1 72.7, 65.2, 62.2, 60.4, 60.0, 59.8, 59.6, 59.2, 59.0, 58.5, 58.0, 57.9, 57.8, 57.6, 56.4, 56.3, 56.0, 55.7, 55.4, 55.3, 55.2, 54.1, 51.0, 41.1, 20.5, 19.6, 19.0, 12.8, 10.6 

Antibody dilution

1:250 1:250 1:110 1:150 

Validation WB

Uncertain: No bands detected Uncertain: Single band larger than predicted size in kDa (+20%) but partly supported by experimental and/or bioinformatic data Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data 

         Protein array

Image

    

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:500 1:2000 1:900 1:1200 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 « 
 
CAMK2D-001
 
CAMK2D-002
 
CAMK2D-003
 
CAMK2D-004
 
CAMK2D-005
 
CAMK2D-006
 
CAMK2D-008
 
CAMK2D-009
 
CAMK2D-012
 
CAMK2D-016
 
CAMK2D-201
 
CAMK2D-202
 
CAMK2D-203
 
CAMK2D-204
 
CAMK2D-205
 
 »