PAM

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA042260

 

Antibody CAB026119

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 R&D Systems
 

Product name

HPA042260 AF4837 

Host species

Rabbit Goat 

Clonality

pAb msAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity 

Released in version

12 6 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein 

Length (aa)

146  

Antigen sequence

HLGKVVSGYRVRNGQWTLIGRQSPQLPQAFYPVGHPVDVSFGDLLAARCV
FTGEGRTEATHIGGTSSDEMCNLYIMYYMEAKHAVSFMTCTQNVAPDMFR
TIPPEANIPIPVKSDMVMMHEHHKETEYKDKIPLLQQPKREEEEVL
 
 

Matching transcripts

PAM-001 - ENSP00000314638 [100%]
PAM-002 - ENSP00000403461 [100%]
PAM-003 - ENSP00000282992 [100%]
PAM-004 - ENSP00000396493 [100%]
PAM-005 - ENSP00000369125 [100%]
PAM-029 - ENSP00000306100 [100%]
PAM-201 - ENSP00000274392 [100%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human small intestine shows strong positivity in a subset of neuroendocrine cells.
More information
 Immunohistochemical staining of human pancreas shows moderate cytoplasmic positivity in islet cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:200 1:100 

Literature conformity

Partly consistent with extensive gene/protein characterization data Partly consistent with extensive gene/protein characterization data 

RNA consistency

Not done Not done 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in cytoplasm.
More information
 Immunofluorescent staining of human cell line A-431 shows positivity in the Golgi apparatus.
More information
 

Antibody dilution

1:44 1:25 

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available. Uncertain: The subcellular location is partly supported by literature or no literature is available. 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
  

Target mass (kDa)

108.4, 108.3, 100.8, 98.8, 97.4, 96.3, 75.6 108.4, 108.3, 100.8, 98.8, 97.4, 96.3, 75.6, 36.7, 27.6, 19.6, 7.5, 5.9, 4.7, 3.1, 3.0, 2.7 

Antibody dilution

1:250 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:3000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
PAM-001
 
PAM-002
 
PAM-003
 
PAM-004
 
PAM-005
 
PAM-029
 
PAM-201