BDP1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA043140

 

Antibody HPA049726

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA043140 HPA049726 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

12 12 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

86 88 

Antigen sequence

PFEMTTSEHIQDEPGTNDGSTEAAITLLTMGDLVLQSEISSEQGDVGVCI
LPHVHSKDKSHIPSSLDNVNHKIVHECQELSSPVIT
 
RDIPIMEKVSGKMAVVEEMEADLKETGKENFRERGSEEICVTEEKVAELK
QTGKTDISPRENELEETSTSRQTDTHLMQSGSNDFSAV
 

Matching transcripts

BDP1-016 - ENSP00000351575 [99%]
BDP1-020 - ENSP00000421910 [98%]
BDP1-201 - ENSP00000370050 [98%]
 BDP1-016 - ENSP00000351575 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line HeLa shows positivity in cytoplasm & nucleus but excluded from the nucleoli.
More information
 Immunofluorescent staining of human cell line A-431 shows positivity in cytoplasm & nucleus but excluded from the nucleoli.
More information
 

Antibody dilution

1:102 1:161 

Validation IF

Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature. 

         Western Blot

Image

  

Description

  

Target mass (kDa)

293.9, 64.6, 51.4 293.9 

Antibody dilution

1:250 1:800 

Validation WB

Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present Non-supportive: Only bands not corresponding to the predicted size 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:6000 1:6400 

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
BDP1-016
 
BDP1-020
 
BDP1-201