IGFBP3

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA013357

 

Antibody CAB010360

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 

Product name

HPA013357 sc-9028 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

4 4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein 

Length (aa)

107  

Antigen sequence

PGNASESEEDRSAGSVESPSVSSTHRVSDPKFHPLHSKIIIIKKGHAKDS
QRYKVDYESQSTDTQNFSSESKRETEYGPCRREMEDTLNHLKFLNVLSPR
GVHIPNC
 
 

Matching transcripts

IGFBP3-001 - ENSP00000275521 [100%]
IGFBP3-008 - ENSP00000370476 [100%]
IGFBP3-020 - ENSP00000370473 [100%]
IGFBP3-201 - ENSP00000477772 [100%]
IGFBP3-202 - ENSP00000480717 [100%]
IGFBP3-014 - ENSP00000389668 [99%]
IGFBP3-019 - ENSP00000399116 [94%]
IGFBP3-018 - ENSP00000390298 [85%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human cerebral cortex shows strong nuclear positivity in neuronal cells.
More information
 Immunohistochemical staining of human stomach shows strong cytoplasmic positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:30 1:40 

Literature conformity

Partly consistent with extensive gene/protein characterization data Partly consistent with extensive gene/protein characterization data 

RNA consistency

Mainly not consistent with RNA expression data Mainly not consistent with RNA expression data 

         Immunofluorescence

Image

  

Description

Application not done for this antibody. Immunofluorescent staining of human cell line A-431 shows positivity in cytoplasm & vesicles.
More information
 

Antibody dilution

 1:10 

Validation IF

 Uncertain: The subcellular location is partly supported by experimental gene/protein characterization data, or no such data is available. 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 229, 107, 78, 46, 31, 26, 16.2
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

32.2, 31.7, 29.7, 29.0, 21.8, 17.5, 16.4, 14.9 32.2, 31.7, 29.7, 29.0, 21.8, 17.5, 16.4, 14.9 

Antibody dilution

1:250 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:500  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
IGFBP3-001
 
IGFBP3-008
 
IGFBP3-014
 
IGFBP3-018
 
IGFBP3-019
 
IGFBP3-020
 
IGFBP3-201
 
IGFBP3-202