IGFBP1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA046972

 

Antibody HPA050640

 

Antibody CAB004445

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 

Product name

HPA046972 HPA050640 sc-25257 

Host species

Rabbit Rabbit Mouse 

Clonality

pAb pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

12 12 3 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Recombinant protein 

Length (aa)

71 93  

Antigen sequence

QQPLHALTRGQGACVQESDASAPHAAEAGSPESPESTEITEEELLDNFHL
MAPSEEDHSILWDAISTYDGS
 
SKALHVTNIKKWKEPCRIELYRVVESLAKAQETSGEEISKFYLPNCNKNG
FYHSRQCETSMDGEAGLCWCVYPWNGKRIPGSPEIRGDPNCQI
 
 

Matching transcripts

IGFBP1-001 - ENSP00000275525 [100%]
IGFBP1-002 - ENSP00000413511 [100%]
IGFBP1-003 - ENSP00000417069 [100%]
 IGFBP1-001 - ENSP00000275525 [100%]
IGFBP1-002 - ENSP00000413511 [98%]
  

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human placenta shows strong cytoplasmic positivity in decidual cells.
More information
 Immunohistochemical staining of human placenta shows strong cytoplasmic positivity in decidual cells.
More information
 Immunohistochemical staining of human placenta shows strong cytoplasmic positivity in decidual cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:85 1:600 1:125 

Validation IH

Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data 

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 16.8
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

27.9, 27.7, 22.9 27.9, 27.7 27.9, 27.7, 22.9 

Antibody dilution

1:200 1:360 1:500 

Validation WB

Uncertain: No bands detected Uncertain: No bands detected Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:1600 1:2850  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%).  
 

ANTIGEN VIEW

? »
 
 
 
IGFBP1-001
 
IGFBP1-002
 
IGFBP1-003