AGBL3

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA020397

 

Antibody HPA024150

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA020397 HPA024150 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

5 5 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

83 90 

Antigen sequence

CPEPVYIPTGLETQPLYPDSKEATVVYLAEDAYKEPCFVYSRVGGNRTPL
KQPVDYRDNTLMFEARFESGNLQKVVKVAEYEY
 
DYSDRTISDEDESDEDMFMKFVSEDLHRCALLTADSFGDPFFPRTTQILL
EYQLGRWVPRLREPRDLYGVSSSGPLSPTRWPYHCEVIDE
 

Matching transcripts

AGBL3-006 - ENSP00000401220 [99%]
AGBL3-007 - ENSP00000388275 [99%]
 AGBL3-006 - ENSP00000401220 [100%]
AGBL3-007 - ENSP00000388275 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.
More information
 Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:25 1:250 

Literature conformity

No avaliable gene/protein characterization data No avaliable gene/protein characterization data 

RNA consistency

Not consistent with RNA expression data Not consistent with RNA expression data 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line U-251 MG shows positivity in cytoplasm.
More information
 Immunofluorescent staining of human cell line U-2 OS shows positivity in mitochondria.
More information
 

Antibody dilution

1:50 1:100 

Validation IF

Uncertain: The subcellular location is partly supported by experimental gene/protein characterization data, or no such data is available. Uncertain: The subcellular location is partly supported by experimental gene/protein characterization data, or no such data is available. 

         Western Blot

Image

  

Description

  

Target mass (kDa)

107.0, 82.1 107.0, 82.1 

Antibody dilution

1:250 1:250 

Validation WB

Current setup is not applicable due to low RNA count Current setup is not applicable due to low RNA count 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:500 1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
AGBL3-006
 
AGBL3-007