KDM6A

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA000568

 

Antibody HPA001165

 

Antibody HPA002111

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA000568 HPA001165 HPA002111 

Host species

Rabbit Rabbit Rabbit 

Clonality

pAb pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

4 1 4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Recombinant protein fragment 

Length (aa)

109 124 142 

Antigen sequence

QLYMKVPGSRTPGHQENNNFCSVNINIGPGDCEWFVVPEGYWGVLNDFCE
KNNLNFLMGSWWPNLEDLYEANVPVYRFIQRPGDLVWINAGTVHWVQAIG
WCNNIAWNV
 
SNSCILLDKCPPPRPPTSPYPPLPKDKLNPPTPSIYLENKRDAFFPPLHQ
FCTNPKNPVTVIRGLAGALKLDLGLFSTKTLVEANNEHMVEVRTQLLQPA
DENWDPTGTKKIWRCESNRSHTTI
 
IGNNHITGSGSNGNVPYLQRNALTLPHNRTNLTSSAEEPWKNQLSNSTQG
LHKGQSSHSAGPNGERPLSSTGPSQHLQAAGSGIQNQNGHPTLPSNSVTQ
GAALNHLSSHTATSGGQQGITLTKESKPSGNILTVPETSRHT
 

Matching transcripts

KDM6A-001 - ENSP00000367203 [100%]
KDM6A-002 - ENSP00000405910 [100%]
KDM6A-003 - ENSP00000398929 [100%]
KDM6A-201 - ENSP00000372355 [100%]
KDM6A-202 - ENSP00000437405 [100%]
KDM6A-203 - ENSP00000443078 [100%]
 KDM6A-001 - ENSP00000367203 [97%]
KDM6A-002 - ENSP00000405910 [97%]
KDM6A-003 - ENSP00000398929 [97%]
KDM6A-201 - ENSP00000372355 [97%]
KDM6A-202 - ENSP00000437405 [97%]
KDM6A-203 - ENSP00000443078 [97%]
 KDM6A-001 - ENSP00000367203 [100%]
KDM6A-002 - ENSP00000405910 [100%]
KDM6A-003 - ENSP00000398929 [100%]
KDM6A-201 - ENSP00000372355 [100%]
KDM6A-202 - ENSP00000437405 [100%]
KDM6A-203 - ENSP00000443078 [100%]
 

Other gene match

UTY - ENSG00000183878 [97%]
 UTY - ENSG00000183878 [100%]
  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human appendix shows dot like positivity in nuclei of some lymphoid cells.
More information
 Immunohistochemical staining of human bone marrow shows distinct cytoplasmic positivity in subsets of hematopoietic cells.
More information
 Immunohistochemical staining of human duodenum shows strong nuclear positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:100 1:750 1:25 

Literature conformity

Consistent with gene/protein characterization data Consistent with gene/protein characterization data Consistent with extensive gene/protein characterization data 

RNA consistency

Not done Not done Not done 

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY402844)
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY402844)
More information
 Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 16.8
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

154.9, 154.4, 154.2, 149.5, 149.3, 145.2, 137.2, 134.8, 113.9, 109.1 154.9, 154.4, 154.2, 149.5, 149.3, 145.2, 137.2, 134.8, 118.1, 117.1, 114.4, 113.9, 110.0, 109.1 154.9, 154.2, 149.3, 145.2, 113.9, 109.1 

Antibody dilution

1:250 1:250 1:250 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Uncertain: No bands detected 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:2000 1:3000 1:500 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 

         Immunofluorescence

Image

   

Description

Application not done for this antibody. Application not done for this antibody. Immunofluorescent staining of human cell line U-2 OS shows positivity in the Golgi apparatus & nucleus but excluded from the nucleoli.
More information
 

Antibody dilution

  1:105 

Validation IF

  Uncertain: The subcellular location is partly supported by literature or no literature is available. 
 

ANTIGEN VIEW

? »
 
 
 
KDM6A-001
 
KDM6A-002
 
KDM6A-003
 
KDM6A-201
 
KDM6A-202
 
KDM6A-203