MSN

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA000263

 

Antibody HPA011135

 

Antibody HPA011227

 

Antibody CAB010898

 

Antibody CAB047336

 

Antibody CAB047338

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 SIGMA
 NCI-CPTC
 NCI-CPTC
 

Product name

HPA000263 HPA011135 HPA011227 M7060 FSAI004:9E7 CPTC-MSN-3 

Host species

Rabbit Rabbit Rabbit Mouse Mouse Mouse 

Clonality

pAb pAb pAb mAb mAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Not known Protein A/G Protein A/G 

Released in version

4 4 4 4 12 9 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Recombinant protein fragment Not known Recombinant protein Recombinant protein 

Length (aa)

122 101 110    

Antigen sequence

SKGYSTWLKLNKKVTQQDVKKENPLQFKFRAKFFPEDVSEELIQEITQRL
FFLQVKEAILNDEIYCPPETAVLLASYAVQAKYGDYNKEIHKPGYLANDR
LLPQRVLEQHKLTKEQWEERIQ
 
KKAQQELEEQTRRALELEQERKRAQSEAEKLAKERQEAEEAKEALLQASR
DQKKTQEQLALEMAELTARISQLEMARQKKESEAVEWQQKAQMVQEDLEK
T
 
AELKTAMSTPHVAEPAENEQDEQDENGAEASADLRADAMAKDRSEEERTT
EAEKNERVQKHLKALTSELANARDESKKTANDMIHAENMRLGRDKYKTLR
QIRQGNTKQR
 
 
 
 

Matching transcripts

MSN-001 - ENSP00000353408 [85%]
 MSN-001 - ENSP00000353408 [100%]
 MSN-001 - ENSP00000353408 [100%]
    

Other gene match

RDX - ENSG00000137710 [100%]
      

ANTIBODY VALIDATION

         Immunohistochemistry

Image

      

Description

Immunohistochemical staining of human tonsil shows positivity in the germinal centre.
More information
 Immunohistochemical staining of human tonsil shows positivity in the germinal centre.
More information
 Immunohistochemical staining of human tonsil shows positivity in the germinal centre.
More information
 Immunohistochemical staining of human tonsil shows positivity in the germinal centre.
More information
  Immunohistochemical staining of human lymph node shows strong cytoplasmic positivity in non-germinal center cells.
More information
 

Retrieval method

HIER pH9 HIER pH6 HIER pH6 HIER pH6  HIER pH6 

Antibody dilution

1:150 1:750 1:75 1:80000  1:60000 

Validation IH

Supportive: The multi-targeting antibody yielding a staining pattern consistent with gene/protein characterization data for all of the genes Supportive: Two (or more) antibodies yielding similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data  Supportive: Two (or more) antibodies yielding similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Western Blot

Image

      

Description

Lane 1: Marker [kDa] 219, 112, 85, 49, 32, 25, 17.5
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: A-431
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
   Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

71.0, 68.6, 67.8, 23.4, 17.3 67.8 67.8 67.8  67.8 

Antibody dilution

1:500 1:250 1:250 1:500  1:500 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present  Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

      

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
    

Antibody dilution

1:2000 1:3000 1:500    

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). Supportive: Pass with single peak corresponding to interaction only with its own antigen. Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%).    

         Immunofluorescence

Image

      

Description

 Immunofluorescent staining of human cell line U-251MG shows positivity in plasma membrane.
More information
  Immunofluorescent staining of human cell line U-251 MG shows positivity in plasma membrane.
More information
 Immunofluorescent staining of human cell line U-2 OS shows positivity in plasma membrane.
More information
 Immunofluorescent staining of human cell line U-2 OS shows positivity in plasma membrane & cytoplasm.
More information
 

Antibody dilution

 1:54  1:2000 1:2000 1:2000 

Validation IF

 Supportive: The subcellular location is supported by literature.  Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature. 
 

ANTIGEN VIEW

? »
 
 
 
MSN-001