LPAR4

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA054951

 

Antibody HPA055571

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA054951 HPA055571 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

12 12 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

46 27 

Antigen sequence

KSFYINAHIRMESLFKTETPLTTKPSLPAIQEEVSDQTTNNGGELM
 
STTNVNNATTTCFEGFSKRVWKTYLSK
 

Matching transcripts

LPAR4-001 - ENSP00000362398 [100%]
LPAR4-201 - ENSP00000408205 [100%]
 LPAR4-001 - ENSP00000362398 [100%]
LPAR4-201 - ENSP00000408205 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells.
More information
 Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in a subset of islet cells of Langerhans.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:45 1:65 

Validation IH

Uncertain: Two (or more) antibodies yielding dissimilar or partly similar staining patterns and there is no available gene/protein characterization data or only limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding dissimilar or partly similar staining patterns and there is no available gene/protein characterization data or only limited gene/protein characterization data 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

41.9 41.9 

Antibody dilution

1:180 1:90 

Validation WB

Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:1400 1:750 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
LPAR4-001
 
LPAR4-201