DIAPH2

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA005647

 

Antibody CAB015461

 

Antibody CAB068183

 

Antibody CAB068184

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 Atlas Antibodies
 Atlas Antibodies
 

Product name

HPA005647 sc-55539 AMAb90856 AMAb90857 

Host species

Rabbit Mouse Mouse Mouse 

Clonality

pAb mAb mAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Protein A/G Protein A/G Protein A/G 

Released in version

3 4 13 13 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein Recombinant protein Recombinant protein 

Length (aa)

134    

Antigen sequence

GGSEEPGGGRSNKRSAGNRAANEEETKNKPKLNIQIKTLADDVRDRITSF
RKSTVKKEKPLIQHPIDSQVAMSEFPAAQPLYDERSLNLSEKEVLDLFEK
MMEDMNLNEEKKAPLRNKDFTTKREMVVQYISAT
 
 
 
 

Matching transcripts

DIAPH2-001 - ENSP00000362140 [100%]
DIAPH2-002 - ENSP00000321348 [100%]
DIAPH2-201 - ENSP00000348082 [100%]
DIAPH2-203 - ENSP00000362152 [100%]
DIAPH2-202 - ENSP00000362145 [92%]
    

Other gene match

    

ANTIBODY VALIDATION

         Immunohistochemistry

Image

    

Description

Immunohistochemical staining of human testis shows cytoplasmic positivity in cells of seminiferus ducts.
More information
 Immunohistochemical staining of human stomach shows strong cytoplasmic positivity in glandular cells.
More information
 Immunohistochemical staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.
More information
 Immunohistochemical staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:200 1:100 1:2000 1:150 

Literature conformity

Consistent with extensive gene/protein characterization data Partly consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data 

RNA consistency

Consistent with RNAseq data Not done Consistent with RNAseq data Consistent with RNAseq data 

         Immunofluorescence

Image

    

Description

Immunofluorescent staining of human cell line U-251 MG shows positivity in nucleoli, the Golgi apparatus & vesicles.
More information
 Application not done for this antibody. Application not done for this antibody. Application not done for this antibody. 

Antibody dilution

1:20    

Validation IF

Supportive: The subcellular location is supported by literature.    

         Western Blot

Image

    

Description

Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 16.8
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

125.6, 125.1, 124.9, 124.8 125.6, 125.1, 124.9, 124.8 125.6, 125.1, 124.9, 124.8 125.6, 125.1, 124.9, 124.8 

Antibody dilution

1:250 1:500 1:1000 1:1000 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

    

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. Application not done for this antibody. Application not done for this antibody. 

Antibody dilution

1:2000    

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.    
 

ANTIGEN VIEW

? »
 
 
 
DIAPH2-001
 
DIAPH2-002
 
DIAPH2-201
 
DIAPH2-202
 
DIAPH2-203