CXorf57

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA000298

 

Antibody HPA000896

 

Antibody HPA001374

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA000298 HPA000896 HPA001374 

Host species

Rabbit Rabbit Rabbit 

Clonality

pAb pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

12 1 10 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Recombinant protein fragment 

Length (aa)

111 117 111 

Antigen sequence

KQVKPEWRLPKLNHRFTTRSELDDMPENCICDVIGLLVFVGRVQRSKKKE
NREDFWSYRWIHIADGTSEQPFIVELFSTSQPEIFENIYPMAYFVCTQLK
VVRNDNQVPKL
 
TISDRWESQLWREKKFGLIDHLHYSRVYPESIPRKFMFEHRKFLSDQYNS
QPAKYVPPEGRPPKLDDFKSARSLGHFEVTILGLNHEIAIDVAFLPMYCP
EDIRTSQIDTLLTSMNY
 
KQVKPEWRLPKLNHRFTTRSELDDMPENCICDVIGLLVFVGRVQRSKKKE
NREDFWSYRWIHIADGTSEQPFIVELFSTSQPEIFENIYPMAYFVCTQLK
VVRNDNQVPKL
 

Matching transcripts

CXorf57-001 - ENSP00000432238 [100%]
CXorf57-002 - ENSP00000361628 [100%]
CXorf57-003 - ENSP00000405866 [100%]
CXorf57-201 - ENSP00000361623 [100%]
 CXorf57-002 - ENSP00000361628 [100%]
CXorf57-003 - ENSP00000405866 [100%]
CXorf57-201 - ENSP00000361623 [100%]
 CXorf57-001 - ENSP00000432238 [100%]
CXorf57-002 - ENSP00000361628 [100%]
CXorf57-003 - ENSP00000405866 [100%]
CXorf57-201 - ENSP00000361623 [100%]
 

Other gene match

   

ANTIBODY VALIDATION

         Immunofluorescence

Image

   

Description

Immunofluorescent staining of human cell line U-251MG shows positivity in nucleus but not nucleoli & cytoplasm.
More information
   

Antibody dilution

1:50   

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available.   

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 219, 112, 85, 49, 32, 25, 17.5
Lane 2: RT-4
Lane 3: EFO-21
Lane 4: A-431
Lane 5: Liver
Lane 6: Tonsil
More information
   

Target mass (kDa)

97.6, 86.6, 65.4, 65.1 97.6, 86.6, 65.1 97.6, 86.6, 65.4, 65.1 

Antibody dilution

1:500 1:500 1:250 

Validation WB

Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:1000 1:1000 1:2000 

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). Supportive: Pass with single peak corresponding to interaction only with its own antigen. Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). 

         Immunohistochemistry

Image

   

Description

 Immunohistochemical staining of human rectum shows strong cytoplasmic positivity in glandular cells.
More information
 Immunohistochemical staining of human placenta shows distinct membranous positivity in trophoblasts.
More information
 

Retrieval method

 HIER pH6 HIER pH6 

Antibody dilution

 1:20 1:100 

Validation IH

 Uncertain: Two (or more) antibodies yielding similar or partly similar staining patterns and there is no available gene/protein characterization data Uncertain: Two (or more) antibodies yielding similar or partly similar staining patterns and there is no available gene/protein characterization data 
 

ANTIGEN VIEW

? »
 
 
 
CXorf57-001
 
CXorf57-002
 
CXorf57-003
 
CXorf57-201