ARHGAP36

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA002064

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA002064 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

2 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

106 

Antigen sequence

NWDVLFQVPPHIQRQVAKRVWKSSPEALDFIRRRNLRKIQSARIKMEEDA
LLSDPVETSAEARAAVLAQSKPSDEGSSEEPAVPSGTARSHDDEEGAGNP
PIPEQD
 

Matching transcripts

ARHGAP36-001 - ENSP00000359959 [100%]
ARHGAP36-002 - ENSP00000359960 [100%]
ARHGAP36-004 - ENSP00000408515 [100%]
ARHGAP36-005 - ENSP00000276211 [100%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human cerebellum shows nuclear positivity in purkinje cells, cells in molecular layer and cells in granular layer.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:10 

Validation IH

Uncertain: One antibody yielding a staining pattern and there is no available gene/protein characterization data or the staining pattern is partly consistent with or contradicted by limited gene/protein characterization data 

         Western Blot

Image

 

Description

 

Target mass (kDa)

61.7, 60.6, 58.3, 46.2 

Antibody dilution

1:500 

Validation WB

Non-supportive: Only bands not corresponding to the predicted size 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:2000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
ARHGAP36-001
 
ARHGAP36-002
 
ARHGAP36-004
 
ARHGAP36-005