NSDHL

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA000248

 

Antibody HPA000571

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA000248 HPA000571 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

1 1 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

125 121 

Antigen sequence

MEPAVSEPMRDQVARTHLTEDTPKVNADIEKVNQNQAKRCTVIGGSGFLG
QHMVEQLLARGYAVNVFDIQQGFDNPQVRFFLGDLCSRQDLYPALKGVNT
VFHCASPPPSSNNKELFYRVNYIGT
 
LPYAMKPIDYYTETKILQERAVLGANDPEKNFLTTAIRPHGIFGPRDPQL
VPILIEAARNGKMKFVIGNGKNLVDFTFVENVVHGHILAAEQLSRDSTLG
GKAFHITNDEPIPFWTFLSRI
 

Matching transcripts

NSDHL-001 - ENSP00000359297 [100%]
NSDHL-002 - ENSP00000396266 [100%]
NSDHL-201 - ENSP00000391854 [100%]
 NSDHL-001 - ENSP00000359297 [100%]
NSDHL-201 - ENSP00000391854 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human testis shows cytoplasmic positivity in Leydig cells.
More information
 Immunohistochemical staining of human adrenal gland shows strong cytoplasmic positivity in cortical cells.
More information
 

Retrieval method

HIER pH9 HIER pH6 

Antibody dilution

1:500 1:50 

Validation IH

Uncertain: Two (or more) antibodies yielding similar or partly similar staining patterns and there is no available gene/protein characterization data Uncertain: Two (or more) antibodies yielding similar or partly similar staining patterns and there is no available gene/protein characterization data 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in endoplasmic reticulum & vesicles.
More information
 Immunofluorescent staining of human cell line U-251MG shows positivity in endoplasmic reticulum & vesicles.
More information
 

Antibody dilution

1:83 1:30 

Validation IF

Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature. 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 206, 113, 82, 49, 32, 26, 17.8
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: A-431
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 206, 113, 82, 49, 32, 26, 17.8
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: A-431
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

41.9, 28.1 41.9 

Antibody dilution

1:250 1:250 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:2000 1:1000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
NSDHL-001
 
NSDHL-002
 
NSDHL-201