CCDC25

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA023256

 

Antibody HPA053047

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA023256 HPA053047 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

5 13 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

59 64 

Antigen sequence

SSAYTIYMGKDKYENEDLIKHGWPEDIWFHVDKLSSAHVYLRLHKGENIE
DIPKEVLMD
 
CAHLVKANSIQGCKMNNVNVVYTPWSNLKKTADMDVGQIGFHRQKDVKIV
TVEKKVNEILNRLE
 

Matching transcripts

CCDC25-001 - ENSP00000348933 [100%]
CCDC25-002 - ENSP00000428505 [100%]
CCDC25-003 - ENSP00000430662 [100%]
CCDC25-013 - ENSP00000429861 [100%]
 CCDC25-001 - ENSP00000348933 [100%]
CCDC25-009 - ENSP00000428000 [100%]
CCDC25-201 - ENSP00000437677 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human duodenum shows moderate cytoplasmic positivity in glandular cells.
More information
 Application not done for this antibody. 

Retrieval method

HIER pH6  

Antibody dilution

1:50  

Literature conformity

Not done  

RNA consistency

Mainly consistent with RNAseq data  

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in the Golgi apparatus & nucleus but excluded from the nucleoli.
More information
 Immunofluorescent staining of human cell line A-431 shows positivity in nucleus but excluded from the nucleoli.
More information
 

Antibody dilution

1:20 1:62 

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available. Uncertain: The subcellular location is partly supported by literature or no literature is available. 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
  

Target mass (kDa)

24.5, 10.6, 10.0 24.5, 16.5 

Antibody dilution

1:250 1:310 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Non-supportive: Only bands not corresponding to the predicted size 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 1:2500 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
CCDC25-001
 
CCDC25-002
 
CCDC25-003
 
CCDC25-009
 
CCDC25-013
 
CCDC25-201