PARD3

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA030443

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA030443 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

6 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

92 

Antigen sequence

LKGLGDMFRIQAKTREFRERQARERDYAEIQDFHRTFGCDDELMYGGVSS
YEGSMALNARPQSPREGHMMDALYAQVKKPRNSKPSPVDSNR
 

Matching transcripts

PARD3-004 - ENSP00000340591 [100%]
PARD3-005 - ENSP00000363926 [100%]
PARD3-002 - ENSP00000363921 [91%]
PARD3-003 - ENSP00000363920 [91%]
PARD3-006 - ENSP00000311986 [91%]
PARD3-010 - ENSP00000363922 [91%]
PARD3-203 - ENSP00000440857 [91%]
PARD3-204 - ENSP00000443147 [91%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human colon shows distinct luminal membranous positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:100 

Validation IH

Uncertain: One antibody yielding a staining pattern and there is no available gene/protein characterization data or the staining pattern is partly consistent with or contradicted by limited gene/protein characterization data 

         Immunofluorescence

Image

 

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in cell junctions.
More information
 

Antibody dilution

1:58 

Validation IF

Supportive: The subcellular location is supported by literature. 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

151.4, 151.1, 149.7, 146.9, 146.3, 144.5, 141.1, 138.3 

Antibody dilution

1:250 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
PARD3-002
 
PARD3-003
 
PARD3-004
 
PARD3-005
 
PARD3-006
 
PARD3-010
 
PARD3-203
 
PARD3-204