LAMTOR1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA002997

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA002997 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

148 

Antigen sequence

NEDSDQDREERKLLLDPSSPPTKALNGAEPNYHSLPSARTDEQALLSSIL
AKTASNIIDVSAADSQGMEQHEYMDRARQYSTRLAVLSSSLTHWKKLPPL
PSLTSQPHQVLASEPIPFSDLQQVSRIAAYAYSALSQIRVDAKEELVV
 

Matching transcripts

LAMTOR1-001 - ENSP00000278671 [100%]
LAMTOR1-004 - ENSP00000439011 [84%]
LAMTOR1-006 - ENSP00000440738 [84%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human rectum shows strong cytoplasmic positivity, with a granular pattern, in glandular cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:150 

Validation IH

Uncertain: One antibody yielding a staining pattern and there is no available gene/protein characterization data or the staining pattern is partly consistent with or contradicted by limited gene/protein characterization data 

         Immunofluorescence

Image

 

Description

Immunofluorescent staining of human cell line A-431 shows positivity in plasma membrane & Golgi apparatus.
More information
 

Antibody dilution

1:45 

Validation IF

Supportive: The subcellular location is supported by literature. 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

17.7, 17.5, 15.7 

Antibody dilution

1:250 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:6000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
LAMTOR1-001
 
LAMTOR1-004
 
LAMTOR1-006