CSRP2BP

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA068443

 

Antibody CAB034224

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 

Product name

HPA068443 sc-85505 

Host species

Rabbit Rabbit 

Clonality

pAb msAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity 

Released in version

14 9 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Synthetic peptide 

Length (aa)

100  

Antigen sequence

IYGAKEGGISRLPAGQATYRTTCQDFRILDRYQTSLPSRKGFRHQTTKFL
YRLVGSEDMAVDQSIVSPYTSRILKPYIRRDYETKPPKLQLLSQIRSHLH
 
 

Matching transcripts

CSRP2BP-001 - ENSP00000392318 [100%]
CSRP2BP-005 - ENSP00000425909 [100%]
CSRP2BP-007 - ENSP00000366909 [100%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Application not done for this antibody. Immunohistochemical staining of human cerebral cortex shows nuclear membrane positivity in neuronal and glial cells.
More information
 

Retrieval method

 HIER pH6 

Antibody dilution

 1:750 

Literature conformity

 Partly consistent with gene/protein characterization data 

RNA consistency

 Not done 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line Hep G2 shows positivity in vesicles.
More information
 Application not done for this antibody. 

Antibody dilution

1:112  

Validation IF

Uncertain: The subcellular location is partly supported by experimental gene/protein characterization data, or no such data is available.  

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
  

Target mass (kDa)

88.8, 74.3 88.8, 74.3, 6.0 

Antibody dilution

1:240 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:4500  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
CSRP2BP-001
 
CSRP2BP-005
 
CSRP2BP-007