CHEK1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA044364

 

Antibody CAB002049

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Novocastra
 

Product name

HPA044364 NCL-Chk1 

Host species

Rabbit Mouse 

Clonality

pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Not known 

Released in version

12 1 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Not known 

Length (aa)

130  

Antigen sequence

KRREFHAEPVDVWSCGIVLTAMLAGELPWDQPSDSCQEYSDWKEKKTYLN
PWKKIDSAPLALLHKILVENPSARITIPDIKKDRWYNKPLKKGAKRPRVT
SGGVSESPSGFSKHIQSNLDFSPVNSASSE
 
 

Matching transcripts

CHEK1-001 - ENSP00000391090 [100%]
CHEK1-002 - ENSP00000412504 [100%]
CHEK1-004 - ENSP00000435371 [100%]
CHEK1-006 - ENSP00000278916 [100%]
CHEK1-007 - ENSP00000432890 [100%]
CHEK1-201 - ENSP00000388648 [100%]
CHEK1-202 - ENSP00000442317 [100%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

 Immunohistochemical staining of human testis shows strong nuclear positivity in cells of seminiferus ducts.
More information
 

Retrieval method

 HIER pH6 

Antibody dilution

 1:50 

Validation IH

 Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Western Blot

Image

  

Description

 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

55.5, 54.4, 50.4, 49.0 55.5, 54.4, 50.4, 49.0, 23.3, 22.3, 19.5, 15.2, 14.4, 4.6 

Antibody dilution

1:250 1:500 

Validation WB

Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present Uncertain: No bands detected 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line MCF-7 shows positivity in nucleus but not nucleoli.
More information
  

Antibody dilution

1:61  

Validation IF

Supportive: The subcellular location is supported by literature.  

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:3000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
CHEK1-001
 
CHEK1-002
 
CHEK1-004
 
CHEK1-006
 
CHEK1-007
 
CHEK1-201
 
CHEK1-202