LPHN3

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA015027

 

Antibody HPA015762

 

Antibody CAB022698

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Chemicon
 

Product name

HPA015027 HPA015762 AB9193 

Host species

Rabbit Rabbit Rabbit 

Clonality

pAb pAb msAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Affinity 

Released in version

5 4 5 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Synthetic peptide 

Length (aa)

150 91  

Antigen sequence

DNLLYVWNNYHVVKYSLDFGPLDSRSGQAHHGQVSYISPPIHLDSELERP
SVKDISTTGPLGMGSTTTSTTLRTTTLSPGRSTTPSVSGRRNRSTSTPSP
AVEVLDDMTTHLPSASSQIPALEESCEAVEAREIMWFKTRQGQIAKQPCP
 
LCLAPDGIWDPQGPDLSNCSSPWVNHITQKLKSGETAANIARELAEQTRN
HLNAGDITYSVRAMDQLVGLLDVQLRNLTPGGKDSAARSLN
 
 

Matching transcripts

LPHN3-001 - ENSP00000423388 [100%]
LPHN3-003 - ENSP00000422533 [100%]
LPHN3-004 - ENSP00000421476 [100%]
LPHN3-006 - ENSP00000425201 [100%]
LPHN3-007 - ENSP00000421627 [100%]
LPHN3-008 - ENSP00000420931 [100%]
LPHN3-009 - ENSP00000425884 [100%]
LPHN3-010 - ENSP00000424258 [100%]
LPHN3-011 - ENSP00000424030 [100%]
LPHN3-012 - ENSP00000423434 [100%]
LPHN3-013 - ENSP00000423787 [100%]
LPHN3-014 - ENSP00000425033 [100%]
LPHN3-015 - ENSP00000424120 [100%]
LPHN3-016 - ENSP00000421372 [100%]
LPHN3-201 - ENSP00000439831 [100%]
 LPHN3-001 - ENSP00000423388 [100%]
LPHN3-002 - ENSP00000424402 [100%]
LPHN3-003 - ENSP00000422533 [100%]
LPHN3-004 - ENSP00000421476 [100%]
LPHN3-006 - ENSP00000425201 [100%]
LPHN3-007 - ENSP00000421627 [100%]
LPHN3-008 - ENSP00000420931 [100%]
LPHN3-009 - ENSP00000425884 [100%]
LPHN3-010 - ENSP00000424258 [100%]
LPHN3-011 - ENSP00000424030 [100%]
LPHN3-012 - ENSP00000423434 [100%]
LPHN3-013 - ENSP00000423787 [100%]
LPHN3-014 - ENSP00000425033 [100%]
LPHN3-015 - ENSP00000424120 [100%]
LPHN3-016 - ENSP00000421372 [100%]
LPHN3-201 - ENSP00000439831 [100%]
  

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human duodenum shows strong cytoplasmic positivity in glandular cells.
More information
 Immunohistochemical staining of human stomach shows cytoplasmic positivity in glandular cells.
More information
 Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in exocrine cells while islet cells were moderately stained.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:400 1:15 1:1000 

Literature conformity

Partly consistent with extensive gene/protein characterization data Partly consistent with extensive gene/protein characterization data Partly consistent with extensive gene/protein characterization data 

RNA consistency

Not done Not done Not done 

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

176.1, 174.9, 170.4, 169.1, 168.0, 164.6, 150.8, 149.6, 146.2, 145.1, 143.8, 142.7, 139.3, 138.1 176.1, 174.9, 170.4, 169.1, 168.0, 164.6, 150.8, 149.6, 146.2, 145.1, 143.8, 142.7, 139.3, 138.1, 102.3 176.1, 174.9, 170.4, 169.1, 168.0, 164.6, 150.8, 149.6, 146.2, 145.1, 143.8, 142.7, 139.3, 138.1, 102.3 

Antibody dilution

1:250 1:250 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:3000 1:500  

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 « 
 
LPHN3-001
 
LPHN3-002
 
LPHN3-003
 
LPHN3-004
 
LPHN3-006
 
LPHN3-007
 
LPHN3-008
 
LPHN3-009
 
LPHN3-010
 
LPHN3-011
 
LPHN3-012
 
LPHN3-013
 
LPHN3-014
 
LPHN3-015
 
LPHN3-016
 
LPHN3-201
 
 »