CTAGE5

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA000387

 

Antibody HPA000922

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA000387 HPA000922 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

2 2 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

116 110 

Antigen sequence

NEMKLHRKLTVEENYRLEKEEKLSKVDEKISHATEELETYRKRAKDLEEE
LERTIHSYQGQIISHEKKAHDNWLAARNAERNLNDLRKENAHNRQKLTET
ELKFELLEKDPYALDV
 
EKEATEAQSLEATCEKLNRSNSELEDEILCLEKELKEEKSKHSEQDELMA
DISKRIQSLEDESKSLKSQVAEAKMTFKIFQMNEERLKIAIKDALNENSQ
LQESQKQLLQ
 

Matching transcripts

CTAGE5-001 - ENSP00000343897 [100%]
CTAGE5-002 - ENSP00000280083 [100%]
CTAGE5-003 - ENSP00000343912 [100%]
CTAGE5-004 - ENSP00000379468 [100%]
CTAGE5-005 - ENSP00000450449 [100%]
CTAGE5-006 - ENSP00000452562 [100%]
CTAGE5-007 - ENSP00000450869 [100%]
CTAGE5-201 - ENSP00000339286 [100%]
CTAGE5-202 - ENSP00000379462 [100%]
 CTAGE5-001 - ENSP00000343897 [100%]
CTAGE5-002 - ENSP00000280083 [100%]
CTAGE5-003 - ENSP00000343912 [100%]
CTAGE5-004 - ENSP00000379468 [100%]
CTAGE5-005 - ENSP00000450449 [100%]
CTAGE5-007 - ENSP00000450869 [100%]
CTAGE5-201 - ENSP00000339286 [100%]
CTAGE5-006 - ENSP00000452562 [96%]
CTAGE5-202 - ENSP00000379462 [96%]
 

Other gene match

CTAGE1 - ENSG00000212710 [82%]
CTAGE4 - ENSG00000225932 [84%]
CTAGE9 - ENSG00000236761 [84%]
CTAGE8 - ENSG00000244693 [84%]
RP11-407N17.3 - ENSG00000258941 [100%]
CTAGE15 - ENSG00000271079 [83%]
CTAGE6 - ENSG00000271321 [83%]
 CTAGE1 - ENSG00000212710 [89%]
CTAGE4 - ENSG00000225932 [82%]
CTAGE9 - ENSG00000236761 [81%]
CTAGE8 - ENSG00000244693 [82%]
RP11-407N17.3 - ENSG00000258941 [100%]
CTAGE15 - ENSG00000271079 [82%]
CTAGE6 - ENSG00000271321 [82%]
 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.
More information
 Immunohistochemical staining of human hippocampus shows strong cytoplasmic positivity in neuronal cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:2000 1:250 

Literature conformity

Partly consistent with gene/protein characterization data Partly consistent with gene/protein characterization data 

RNA consistency

Not done Not done 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 230, 110, 82, 49.3, 32.2, 25.5, 17.6
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: A-431
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 230, 110, 82, 49.3, 32.2, 25.5, 17.6
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: A-431
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

151.7, 91.6, 91.0, 89.6, 88.1, 88.0, 87.9, 87.8, 86.8, 86.5, 85.3, 82.4, 81.8 151.7, 91.6, 91.0, 89.6, 88.1, 88.0, 87.9, 87.8, 86.8, 86.5, 85.3, 82.4, 81.8 

Antibody dilution

1:250 1:250 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:2000 1:1000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
CTAGE5-001
 
CTAGE5-002
 
CTAGE5-003
 
CTAGE5-004
 
CTAGE5-005
 
CTAGE5-006
 
CTAGE5-007
 
CTAGE5-201
 
CTAGE5-202