DLG2

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA021307

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA021307 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

5 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

84 

Antigen sequence

KVGKPTTIYMTDPYGPPDITHSYSPPMENHLLSGNNGTLEYKTSLPPISP
GRYSPIPKHMLVDDDYTRPPEPVYSTVNKLCDKP
 

Matching transcripts

DLG2-001 - ENSP00000381355 [100%]
DLG2-002 - ENSP00000381346 [100%]
DLG2-003 - ENSP00000365272 [100%]
DLG2-009 - ENSP00000435849 [100%]
DLG2-012 - ENSP00000432894 [100%]
DLG2-014 - ENSP00000433848 [100%]
DLG2-015 - ENSP00000381353 [100%]
DLG2-201 - ENSP00000280241 [100%]
DLG2-203 - ENSP00000443248 [100%]
DLG2-204 - ENSP00000441994 [100%]
DLG2-013 - ENSP00000402275 [80%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human cerebellum shows strong cytoplasmic positivity in purkinje cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:300 

Validation IH

Supportive: One antibody yielding a staining pattern which is consistent with gene/protein characterization data 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

109.4, 101.0, 97.6, 96.5, 95.0, 90.7, 87.9, 83.4, 69.6, 59.3 

Antibody dilution

1:250 

Validation WB

Uncertain: No bands detected 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 « 
 
DLG2-001
 
DLG2-002
 
DLG2-003
 
DLG2-009
 
DLG2-012
 
DLG2-013
 
DLG2-014
 
DLG2-015
 
DLG2-201
 
DLG2-203
 
DLG2-204
 
 »