IL18

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA003980

 

Antibody CAB007772

 

Antibody CAB027385

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Epitomics
 NCI-CPTC
 

Product name

HPA003980 1687-1 CPTC-IL18-1 

Host species

Rabbit Rabbit Mouse 

Clonality

pAb mAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Supernatant Protein A/G 

Released in version

4 3 6 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Synthetic peptide Recombinant protein 

Length (aa)

151   

Antigen sequence

MAAEPVEDNCINFVAMKFIDNTLYFIAEDDENLESDYFGKLESKLSVIRN
LNDQVLFIDQGNRPLFEDMTDSDCRDNAPRTIFIISMYKDSQPRGMAVTI
SVKCEKISTLSCENKIISFKEMNPPDNIKDTKSDIIFFQRSVPGHDNKMQ
F
 
 
 

Matching transcripts

IL18-001 - ENSP00000280357 [100%]
IL18-006 - ENSP00000434161 [100%]
IL18-003 - ENSP00000434561 [97%]
   

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human lymph node shows secreted positivity.
More information
 Immunohistochemical staining of human lymph node shows distinct secreted positivity in a subset of reaction center cells.
More information
 Immunohistochemical staining of human tonsil shows distinct secreted positivity in subsets of lymphoid cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:150 1:600 1:1000 

Validation IH

Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Immunofluorescence

Image

   

Description

Immunofluorescent staining of human cell line U-251 MG shows positivity in nucleus but not nucleoli & golgi apparatus.
More information
 Immunofluorescent staining of human cell line A-431 shows no positivity.
More information
 Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli & cytoplasm.
More information
 

Antibody dilution

1:56 1:150 1:400 

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available. Uncertain: The subcellular location is partly supported by literature or no literature is available. Uncertain: The subcellular location is partly supported by literature or no literature is available. 

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 230, 110, 82, 49.3, 32.2, 25.5, 17.6
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 16.8
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

22.3, 21.9 22.3, 21.9 22.3, 21.9 

Antibody dilution

1:250 1:500 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
   

Antibody dilution

1:3000   

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.   
 

ANTIGEN VIEW

? »
 
 
 
IL18-001
 
IL18-003
 
IL18-006