FOXO1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA001252

 

Antibody CAB022326

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Chemicon
 

Product name

HPA001252 MAB10143 

Host species

Rabbit Mouse 

Clonality

pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Serum 

Released in version

2 6 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein 

Length (aa)

149  

Antigen sequence

LTSDSPPHNDIMTPVDPGVAQPNSRVLGQNVMMGPNSVMSTYGSQASHNK
MMNPSSHTHPGHAQQTSAVNGRPLPHTVSTMPHTSGMNRLTQVKTPVQVP
LPHPMQMSALGGYSSVSSCNGYGRMGLLHQEKLPSDLDGMFIERLDCDM
 
 

Matching transcripts

FOXO1-001 - ENSP00000368880 [100%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.
More information
 Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic and nuclear positivity in neuronal cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:25 1:200 

Validation IH

Supportive: Two (or more) antibodies yielding partly similar staining patterns which are consistent with gene/protein characterization data Uncertain: Two (or more) antibodies yielding similar or partly similar staining patterns which are partly consistent with or contradicted by limited gene/protein characterization data 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 206, 113, 82, 49, 32, 26, 17.8
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: A-431
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

69.7 69.7 

Antibody dilution

1:250 1:500 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Uncertain: No bands detected 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:3000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  

         Immunofluorescence

Image

  

Description

 Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli & cytoplasm.
More information
 

Antibody dilution

 1:50 

Validation IF

 Supportive: The subcellular location is supported by literature. 
 

ANTIGEN VIEW

? »
 
 
 
FOXO1-001