PTPRO

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA034525

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA034525 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

7 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

134 

Antigen sequence

TRVNISYWEGKDFRTMLYKDFFKGKTVFNHWLPGMCYSNITFQLVSEATF
NKSTLVEYSGVSHEPKQHRTAPYPPQNISVRIVNLNKNNWEEQSGNFPEE
SFMRSQDTIGKEKLFHFTEETPEIPSGNISSGWP
 

Matching transcripts

PTPRO-001 - ENSP00000281171 [100%]
PTPRO-002 - ENSP00000343434 [100%]
PTPRO-003 - ENSP00000444173 [100%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human kidney shows strong cytoplasmic and membranous positivity in renal glomeruli.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:100 

Validation IH

Supportive: One antibody yielding a staining pattern which is consistent with gene/protein characterization data 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY410737)
More information
 

Target mass (kDa)

138.3, 134.9, 67.7 

Antibody dilution

1:250 

Validation WB

Uncertain: No bands detected 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
PTPRO-001
 
PTPRO-002
 
PTPRO-003