ADAM17

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA010738

 

Antibody HPA051575

 

Antibody CAB025906

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 R&D systems
 

Product name

HPA010738 HPA051575 MAB9301 

Host species

Rabbit Rabbit Mouse 

Clonality

pAb pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

3 12 6 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Recombinant protein 

Length (aa)

133 126  

Antigen sequence

SEYTVKWQDFFTGHVVGEPDSRVLAHIRDDDVIIRINTDGAEYNIEPLWR
FVNDTKDKRMLVYKSEDIKNVSRLQSPKVCGYLKVDNEELLPKGLVDREP
PEELVHRVKRRADPDPMKNTCKLLVVADHRFYR
 
KSYPNEEKDAWDVKMLLEQFSFDIAEEASKVCLAHLFTYQDFDMGTLGLA
YVGSPRANSHGGVCPKAYYSPVGKKNIYLNSGLTSTKNYGKTILTKEADL
VTTHELGHNFGAEHDPDGLAECAPNE
 
 

Matching transcripts

ADAM17-001 - ENSP00000309968 [100%]
ADAM17-003 - ENSP00000418728 [100%]
 ADAM17-001 - ENSP00000309968 [100%]
  

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human small intestine shows membranous and cytoplasmic positivity.
More information
  Immunohistochemical staining of human stomach, upper shows cytoplasmic and nuclear positivity.
More information
 

Retrieval method

HIER pH6  HIER pH6 

Antibody dilution

1:15  1:75 

Validation IH

Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data  Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Immunofluorescence

Image

   

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in cytoplasm.
More information
 Immunofluorescent staining of human cell line U-251 MG shows positivity in cytoplasm.
More information
  

Antibody dilution

1:15 1:66  

Validation IF

Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature.  

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

93.0, 33.2 93.0 93.0, 33.2 

Antibody dilution

1:250 1:80 1:500 

Validation WB

Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:500 1:500  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
ADAM17-001
 
ADAM17-003