KCNJ16

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA059563

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA059563 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

12 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

79 

Antigen sequence

CSAKQLDWKDQQLHIEKAPPVRESCTSDTKARRRSFSAVAIVSSCENPEE
TTTSATHEYRETPYQKALLTLNRISVESQ
 

Matching transcripts

KCNJ16-001 - ENSP00000465295 [100%]
KCNJ16-002 - ENSP00000465967 [100%]
KCNJ16-006 - ENSP00000467568 [100%]
KCNJ16-201 - ENSP00000283936 [100%]
KCNJ16-202 - ENSP00000376438 [100%]
KCNJ16-203 - ENSP00000376439 [100%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:250 

Validation IH

Uncertain: One antibody yielding a staining pattern and there is no available gene/protein characterization data or the staining pattern is partly consistent with or contradicted by limited gene/protein characterization data 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

52.4, 51.9, 47.9 

Antibody dilution

1:490 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:5950 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
KCNJ16-001
 
KCNJ16-002
 
KCNJ16-006
 
KCNJ16-201
 
KCNJ16-202
 
KCNJ16-203