CACNA2D1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA008213

 

Antibody HPA008621

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA008213 HPA008621 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

4 4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

141 113 

Antigen sequence

QPKNPKSQEPVTLDFLDAELENDIKVEIRNKMIDGESGEKTFRTLVKSQD
ERYIDKGNRTYTWTPVNGTDYSLALVLPTYSFYYIKAKLEETITQARSKK
GKMKDSETLKPDNFEESGYTFIAPRDYCNDLKISDNNTEFL
 
QFLLSLTFPRLLEAVEMEDDDFTASLSKQSCITEQTQYFFDNDSKSFSGV
LDCGNCSRIFHGEKLMNTNLIFIMVESKGTCPCDTRLLIQAEQTSDGPNP
CDMVKQPRYRKGP
 

Matching transcripts

CACNA2D1-001 - ENSP00000349320 [100%]
CACNA2D1-201 - ENSP00000348589 [92%]
CACNA2D1-005 - ENSP00000409374 [90%]
 CACNA2D1-001 - ENSP00000349320 [100%]
CACNA2D1-201 - ENSP00000348589 [100%]
CACNA2D1-202 - ENSP00000443124 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.
More information
 Immunohistochemical staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:75 1:25 

Validation IH

Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data 

         Western Blot

Image

  

Description

  

Target mass (kDa)

124.6, 123.2, 32.4 124.6, 123.2, 33.8 

Antibody dilution

1:250 1:250 

Validation WB

Non-supportive: Only bands not corresponding to the predicted size Non-supportive: Only bands not corresponding to the predicted size 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 1:500 

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
CACNA2D1-001
 
CACNA2D1-005
 
CACNA2D1-201
 
CACNA2D1-202