TOMM70A

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA014589

 

Antibody HPA048020

 

Antibody CAB017156

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Kazusa DNA Research Institute
 

Product name

HPA014589 HPA048020 GX0242 

Host species

Rabbit Rabbit Rabbit 

Clonality

pAb pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Not known 

Released in version

4 13 4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Recombinant protein 

Length (aa)

130 123  

Antigen sequence

PLLSTQDFNMAADIDPQNADVYHHRGQLKILLDQVEEAVADFDECIRLRP
ESALAQAQKCFALYRQAYTGNNSSQIQAAMKGFEEVIKKFPRCAEGYALY
AQALTDQQQFGKADEMYDKCIDLEPDNATT
 
YTEAISLCPTEKNVDLSTFYQNRAAAFEQLQKWKEVAQDCTKAVELNPKY
VKALFRRAKAHEKLDNKKECLEDVTAVCILEGFQNQQSMLLADKVLKLLG
KEKAKEKYKNREPLMPSPQFIKS
 
 

Matching transcripts

TOMM70A-001 - ENSP00000284320 [100%]
 TOMM70A-001 - ENSP00000284320 [100%]
  

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells, cells in the granular and molecular layer.
More information
 Immunohistochemical staining of human rectum shows strong cytoplasmic positivity in glandular cells.
More information
 Immunohistochemical staining of human duodenum shows moderate granular cytoplasmic positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:80 1:700 1:800 

Literature conformity

Consistent with extensive gene/protein characterization data No avaliable characterization data Consistent with extensive gene/protein characterization data 

RNA consistency

Not done Consistent with RNAseq data Not done 

         Immunofluorescence

Image

   

Description

Immunofluorescent staining of human cell line A-431 shows positivity in mitochondria.
More information
 Immunofluorescent staining of human cell line U-2 OS shows positivity in mitochondria.
More information
 Immunofluorescent staining of human cell line A-431 shows positivity in mitochondria.
More information
 

Antibody dilution

1:65 1:94 1:200 

Validation IF

Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature. 

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

67.5 67.5 67.5 

Antibody dilution

1:250 1:470 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:3000 1:3800  

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%).  

         siRNA

Image

   

Description

Application not done for this antibody. Signal downregulation > 25% by both siRNA:s.
More information
 Application not done for this antibody. 

Antibody dilution

 1:94  

Validation siRNA

 Supportive: The siRNA validation is supportive.  
 

ANTIGEN VIEW

? »
 
 
 
TOMM70A-001