ABCA5

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA022032

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA022032 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

5 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

74 

Antigen sequence

PNKKYEEVPNIELNPMDKFTLSNLILGYTPVTNITSSIMQKVSTDHLPDV
IITEEYTNEKEMLTSSLSKPSNFV
 

Matching transcripts

ABCA5-001 - ENSP00000376443 [100%]
ABCA5-002 - ENSP00000467815 [100%]
ABCA5-003 - ENSP00000467448 [100%]
ABCA5-004 - ENSP00000467882 [100%]
ABCA5-005 - ENSP00000467524 [100%]
ABCA5-011 - ENSP00000466662 [100%]
ABCA5-201 - ENSP00000376444 [100%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human colon shows strong cytoplasmic positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:35 

Validation IH

Uncertain: One antibody yielding a staining pattern which is partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

186.6, 186.5, 103.6, 28.5, 14.8 

Antibody dilution

1:250 

Validation WB

Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
ABCA5-001
 
ABCA5-002
 
ABCA5-003
 
ABCA5-004
 
ABCA5-005
 
ABCA5-011
 
ABCA5-201