MARCKS

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA051913

 

Antibody HPA054820

 

Antibody CAB022062

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Upstate
 

Product name

HPA051913 HPA054820 05-337  

Host species

Rabbit Rabbit Mouse 

Clonality

pAb pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Not known 

Released in version

12 12 5 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Not known 

Length (aa)

35 34  

Antigen sequence

DPQEAKPQEAAVAPEKPPASDETKAAEEPSKVEEK
 
MGAQFSKTAAKGEAAAERPGEAAVASSPSKANGQ
 
 

Matching transcripts

MARCKS-001 - ENSP00000357624 [100%]
 MARCKS-001 - ENSP00000357624 [100%]
  

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

  Immunohistochemical staining of human placenta shows cytoplasmic positivity in trophoblastic cells.
More information
 

Retrieval method

  HIER pH6 

Antibody dilution

  1:3500 

Validation IH

  Uncertain: One antibody yielding a staining pattern which is partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Western Blot

Image

   

Description

 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
  

Target mass (kDa)

31.6 31.6 31.6 

Antibody dilution

1:320 1:290 1:500 

Validation WB

Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present 

         Immunofluorescence

Image

   

Description

Immunofluorescent staining of human cell line U-251 MG shows positivity in nucleoli & plasma membrane.
More information
 Immunofluorescent staining of human cell line U-251 MG shows positivity in cytoplasm.
More information
  

Antibody dilution

1:65 1:57  

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available. Uncertain: The subcellular location is partly supported by literature or no literature is available.  

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:2600 1:2300  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
MARCKS-001