ACPL2

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA017243

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA017243 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

126 

Antigen sequence

STPKNGMSSKSRKRIMPDPVTEPPVTDPVYEALLYCNIPSVAERSMEGHA
PHHFKLVSVHVFIRHGDRYPLYVIPKTKRPEIDCTLVANRKPYHPKLEAF
ISHMSKGSGASFESPLNSLPLYPNHP
 

Matching transcripts

ACPL2-001 - ENSP00000286353 [100%]
ACPL2-003 - ENSP00000376733 [100%]
ACPL2-004 - ENSP00000426877 [100%]
ACPL2-005 - ENSP00000422901 [100%]
ACPL2-201 - ENSP00000376731 [100%]
ACPL2-002 - ENSP00000422558 [95%]
ACPL2-013 - ENSP00000423702 [95%]
ACPL2-006 - ENSP00000421271 [90%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human rectum shows strong cytoplasmic positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:10 

Validation IH

Uncertain: One antibody yielding a staining pattern and there is no available gene/protein characterization data or the staining pattern is partly consistent with or contradicted by limited gene/protein characterization data 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY403459)
More information
 

Target mass (kDa)

55.2, 54.2, 53.3, 53.2, 51.0, 16.4, 14.8 

Antibody dilution

1:250 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:500 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
ACPL2-001
 
ACPL2-002
 
ACPL2-003
 
ACPL2-004
 
ACPL2-005
 
ACPL2-006
 
ACPL2-013
 
ACPL2-201