ADCY8

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA024291

 

Antibody CAB018652

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 

Product name

HPA024291 sc-20764 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

5 4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein 

Length (aa)

86  

Antigen sequence

DRRNSGATFTEGSWSPELPFDNIVGKQNTLAALTRNSINLLPNHLAQALH
VQSGPEEINKRIEHTIDLRSGDKLRREHIKPFSLMF
 
 

Matching transcripts

ADCY8-001 - ENSP00000286355 [100%]
ADCY8-002 - ENSP00000367161 [100%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human small intestine shows strong cytoplasmic positivity in glandular cells.
More information
 Immunohistochemical staining of human duodenum shows strong cytoplasmic positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:100 1:100 

Literature conformity

Partly consistent with extensive gene/protein characterization data Partly consistent with extensive gene/protein characterization data 

RNA consistency

Not done Not done 

         Western Blot

Image

  

Description

  

Target mass (kDa)

140.1, 125.2 140.1, 125.2, 29.0 

Antibody dilution

1:250 1:500 

Validation WB

Non-supportive: Only bands not corresponding to the predicted size Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:3000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
ADCY8-001
 
ADCY8-002