BACH1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA003175

 

Antibody HPA034949

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA003175 HPA034949 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

2 12 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

135 98 

Antigen sequence

EPLIQFAYTAKLILSKENVDEVCKCVEFLSVHNIEESCFQFLKFKFLDST
ADQQECPRKKCFSSHCQKTDLKLSLLDQRDLETDEVEEFLENKNVQTPQC
KLRRYQGNAKASPPLQDSASQTYESMCLEKDAALA
 
LGIRISESPEPGQRTFTTLSSVNCPFISTLSTEGCSSNLEIGNDDYVSEP
QQEPCPYACVISLGDDSETDTEGDSESCSAREQECEVKLPFNAQRIIS
 

Matching transcripts

BACH1-001 - ENSP00000286800 [100%]
BACH1-002 - ENSP00000382805 [100%]
BACH1-004 - ENSP00000400576 [100%]
BACH1-005 - ENSP00000408605 [100%]
 BACH1-001 - ENSP00000286800 [100%]
BACH1-002 - ENSP00000382805 [100%]
BACH1-006 - ENSP00000416569 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human colon shows strong cytoplasmic positivity in glandular cells.
More information
  

Retrieval method

HIER pH6  

Antibody dilution

1:100  

Validation IH

Uncertain: One antibody yielding a staining pattern which is partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data  

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line U-251 MG shows positivity in nucleus but not nucleoli.
More information
 Immunofluorescent staining of human cell line A-431 shows positivity in nucleus but excluded from the nucleoli.
More information
 

Antibody dilution

1:65 1:33 

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available. Uncertain: The subcellular location is partly supported by literature or no literature is available. 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 16.8
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
  

Target mass (kDa)

82.0, 25.5, 25.0 82.0, 24.5 

Antibody dilution

1:250 1:250 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 1:500 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
BACH1-001
 
BACH1-002
 
BACH1-004
 
BACH1-005
 
BACH1-006