TSPAN7

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA003140

 

Antibody CAB062566

 

Antibody CAB068245

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
 Atlas Antibodies
 

Product name

HPA003140 AMAb90621 AMAb90624 

Host species

Rabbit Mouse Mouse 

Clonality

pAb mAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Protein A/G Protein A/G 

Released in version

2 12 13 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein Recombinant protein 

Length (aa)

93   

Antigen sequence

TFLRTYTDAMQTYNGNDERSRAVDHVQRSLSCCGVQNYTNWSTSPYFLEH
GIPPSCCMNETDCNPQDLHNLTVAATKVNQKGCYDLVTSFMET
 
 
 

Matching transcripts

TSPAN7-001 - ENSP00000367743 [100%]
TSPAN7-005 - ENSP00000286824 [100%]
TSPAN7-201 - ENSP00000388954 [100%]
TSPAN7-202 - ENSP00000441540 [100%]
   

Other gene match

TM4SF2 - ENSG00000250349 [100%]
   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in islet cells.
More information
 Immunohistochemical staining of human small intestine shows strong cytoplasmic positivity in fraction of glandular cells of small intestine.
More information
 Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in islets of Langerhans.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:250 1:1000 1:1200 

Literature conformity

Partly consistent with extensive gene/protein characterization data Partly consistent with extensive gene/protein characterization data Partly consistent with extensive gene/protein characterization data 

RNA consistency

Not done Mainly consistent with RNAseq data Mainly consistent with RNAseq data 

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY401460)
More information
  Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

31.1, 29.9, 29.4, 27.6, 24.5 29.9, 29.4, 27.6, 24.5, 7.5, 5.4, 5.1 29.9, 29.4, 27.6, 24.5, 7.5, 5.4, 5.1 

Antibody dilution

1:250 1:500 1:1000 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present Uncertain: No bands detected 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. Application not done for this antibody. 

Antibody dilution

1:2000   

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.   
 

ANTIGEN VIEW

? »
 
 
 
TSPAN7-001
 
TSPAN7-005
 
TSPAN7-201
 
TSPAN7-202