CDK20

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA007666

 

Antibody HPA027379

 

Antibody HPA027401

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA007666 HPA027379 HPA027401 

Host species

Rabbit Rabbit Rabbit 

Clonality

pAb pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

6 6 6 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Recombinant protein fragment 

Length (aa)

94 63 74 

Antigen sequence

RSVGCIMGELLNGSPLFPGKNDIEQLCYVLRILGTPNPQVWPELTELPDY
NKISFKEQVPMPLEEVLPDVSPQALDLLGQFLLYPPHQRIAASK
 
LLHQYFFTAPLPAHPSELPIPQRLGGPAPKAHPGPPHIHDFHVDRPLEES
LLNPELIRPFILE
 
MDQYCILGRIGEGAHGIVFKAKHVETGEIVALKKVALRRLEDGFPNQALR
EIKALQEMEDNQYVVQLKAVFPHG
 

Matching transcripts

CDK20-001 - ENSP00000365043 [100%]
CDK20-005 - ENSP00000338975 [100%]
CDK20-012 - ENSP00000474485 [100%]
CDK20-004 - ENSP00000322343 [99%]
 CDK20-001 - ENSP00000365043 [100%]
CDK20-004 - ENSP00000322343 [100%]
CDK20-005 - ENSP00000338975 [100%]
 CDK20-001 - ENSP00000365043 [100%]
CDK20-004 - ENSP00000322343 [100%]
CDK20-006 - ENSP00000365031 [100%]
CDK20-012 - ENSP00000474485 [100%]
CDK20-005 - ENSP00000338975 [85%]
 

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human kidney shows strong cytoplasmic and membranous positivity in cells of tubules.
More information
 Immunohistochemical staining of human duodenum shows strong granular cytoplasmic positivity in glandular cells.
More information
 Immunohistochemical staining of human heart muscle shows strong cytoplasmic positivity in myocytes.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:45 1:50 1:40 

Validation IH

Uncertain: Two (or more) antibodies yielding dissimilar or partly similar staining patterns and there is no available gene/protein characterization data or only limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding similar or partly similar staining patterns which are partly consistent with or contradicted by limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding dissimilar or partly similar staining patterns and there is no available gene/protein characterization data or only limited gene/protein characterization data 

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY421833)
More information
 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY421833)
More information
 

Target mass (kDa)

38.7, 37.6, 36.1, 30.6 38.7, 37.6, 36.1 38.7, 37.6, 36.1, 30.6, 27.1 

Antibody dilution

1:250 1:250 1:250 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 1:3000 1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
CDK20-001
 
CDK20-004
 
CDK20-005
 
CDK20-006
 
CDK20-012