AIFM1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA030611

 

Antibody CAB003764

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Epitomics
 

Product name

HPA030611 1020-1 

Host species

Rabbit Rabbit 

Clonality

pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Supernatant 

Released in version

12 2 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Synthetic peptide 

Length (aa)

109  

Antigen sequence

GLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLG
RRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLV
DSSLPTVGV
 
 

Matching transcripts

AIFM1-001 - ENSP00000287295 [100%]
AIFM1-002 - ENSP00000315122 [100%]
AIFM1-003 - ENSP00000316320 [100%]
AIFM1-004 - ENSP00000431222 [100%]
AIFM1-201 - ENSP00000405879 [100%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.
More information
 Immunohistochemical staining of human stomach shows strong cytoplasmic positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:100 1:50 

Validation IH

Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 230, 110, 82, 49.3, 32.2, 25.5, 17.6
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: A-431
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

66.9, 66.3, 35.6, 29.9, 28.4 66.9, 66.3, 35.6, 35.4, 29.9, 28.4, 26.0, 9.5, 4.8 

Antibody dilution

1:250 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:500  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
AIFM1-001
 
AIFM1-002
 
AIFM1-003
 
AIFM1-004
 
AIFM1-201