MAPK13

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA007667

 

Antibody CAB025854

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 R&D systems
 

Product name

HPA007667 AF1519 

Host species

Rabbit Rabbit 

Clonality

pAb msAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity 

Released in version

3 6 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein 

Length (aa)

138  

Antigen sequence

KTLFKGKDYLDQLTQILKVTGVPGTEFVQKLNDKAAKSYIQSLPQTPRKD
FTQLFPRASPQAADLLEKMLELDVDKRLTAAQALTHPFFEPFRDPEEETE
AQQPFDDSLEHEKLTVDEWKQHIYKEIVNFSPIARKDS
 
 

Matching transcripts

MAPK13-001 - ENSP00000211287 [100%]
MAPK13-201 - ENSP00000362866 [100%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human spleen shows strong cytoplasmic positivity in cells in red pulp and white pulp).
More information
 Immunohistochemical staining of human urinary bladder shows strong cytoplasmic and nuclear positivity in urothelial cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:100 1:700 

Validation IH

Uncertain: Two (or more) antibodies yielding dissimilar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding dissimilar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

42.1, 41.0 42.1, 41.0, 28.8, 17.3 

Antibody dilution

1:250 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:3000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
MAPK13-001
 
MAPK13-201