SST

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA019472

 

Antibody CAB000075

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 DakoCytomation
 

Product name

HPA019472 A0566 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Serum 

Released in version

5 1 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Synthetic peptide 

Length (aa)

83  

Antigen sequence

APSDPRLRQFLQKSLAAAAGKQELAKYFLAELLSEPNQTENDALEPEDLS
QAAEQDEMRLELQRSANSNPAMAPRERKAGCKN
 
 

Matching transcripts

SST-001 - ENSP00000287641 [100%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human stomach shows strong positivity in enteroendocrine cells.
More information
 Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in islet cells.
More information
 

Retrieval method

HIER pH6 HIER pH9 

Antibody dilution

1:700 1:4000 

Validation IH

Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY420765)
More information
  

Target mass (kDa)

12.7 12.7 

Antibody dilution

1:250 1:500 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:3000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
SST-001