NTAN1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA051418

 

Antibody CAB029997

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 BioLegend
 

Product name

HPA051418 120801 

Host species

Rabbit Rat 

Clonality

pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

12 7 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Not known 

Length (aa)

87  

Antigen sequence

SDHAQCGRLEVHLVGGFSDDRQLSQKLTHQLLSEFDRQEDDIHLVTLCVT
ELNDREENENHFPVIYGIAVNIKTAEIYRASFQDRGP
 
 

Matching transcripts

NTAN1-001 - ENSP00000287706 [100%]
NTAN1-006 - ENSP00000455396 [100%]
NTAN1-007 - ENSP00000454883 [100%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human lung shows strong cytoplasmic positivity in pneumocytes.
More information
 Immunohistochemical staining of human corpus, uterine shows strong cytoplasmic and membranous positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:60 1:450 

Validation IH

Uncertain: Two (or more) antibodies yielding similar or partly similar staining patterns and there is no available gene/protein characterization data Uncertain: Two (or more) antibodies yielding similar or partly similar staining patterns and there is no available gene/protein characterization data 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
  

Target mass (kDa)

34.7, 25.1, 16.8 34.7, 25.1, 16.8, 5.1, 3.1, 2.0 

Antibody dilution

1:80 1:500 

Validation WB

Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data Non-supportive: Only bands not corresponding to the predicted size 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line A-431 shows positivity in nucleus but not nucleoli & golgi apparatus.
More information
  

Antibody dilution

1:7  

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available.  

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:550  

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%).  
 

ANTIGEN VIEW

? »
 
 
 
NTAN1-001
 
NTAN1-006
 
NTAN1-007