KIT

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA004471

 

Antibody CAB003288

 

Antibody CAB068253

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 DakoCytomation
 Atlas Antibodies
 

Product name

HPA004471 A4502 AMAb90901 

Host species

Rabbit Rabbit Mouse 

Clonality

pAb msAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity Protein A/G 

Released in version

3 2 13 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Synthetic peptide Recombinant protein 

Length (aa)

141   

Antigen sequence

VGDEIRLLCTDPGFVKWTFEILDETNENKQNEWITEKAEATNTGKYTCTN
KHGLSNSIYVFVRDPAKLFLVDRSLYGKEDNDTLVRCPLTDPEVTNYSLK
GCQGKPLPKDLRFIPDPKAGIMIKSVKRAYHRLCLHCSVDQ
 
 
 

Matching transcripts

KIT-001 - ENSP00000288135 [100%]
KIT-002 - ENSP00000390987 [100%]
   

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human breast shows strong cytoplasmic and membranous positivity in glandular cells.
More information
 Immunohistochemical staining of human cerebellum shows moderate cytoplasmic positivity in cells in molecular layer.
More information
 Immunohistochemical staining of human small intestine shows distinct positivity in peripheral leukocytes.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:250 1:300 1:1000 

Literature conformity

Partly consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data Partly consistent with extensive gene/protein characterization data 

RNA consistency

Mainly not consistent with RNAseq data Not done Mainly not consistent with RNAseq data 

         Western Blot

Image

   

Description

  Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

109.9, 109.4 109.9, 109.4 109.9, 109.4 

Antibody dilution

1:250 1:500 1:1000 

Validation WB

Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. Application not done for this antibody. 

Antibody dilution

1:3000   

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.   
 

ANTIGEN VIEW

? »
 
 
 
KIT-001
 
KIT-002