KIT

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA004471

 

Antibody CAB003288

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 DakoCytomation
 

Product name

HPA004471 A4502 

Host species

Rabbit Rabbit 

Clonality

pAb msAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity 

Released in version

3 2 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Synthetic peptide 

Length (aa)

141  

Antigen sequence

VGDEIRLLCTDPGFVKWTFEILDETNENKQNEWITEKAEATNTGKYTCTN
KHGLSNSIYVFVRDPAKLFLVDRSLYGKEDNDTLVRCPLTDPEVTNYSLK
GCQGKPLPKDLRFIPDPKAGIMIKSVKRAYHRLCLHCSVDQ
 
 

Matching transcripts

KIT-001 - ENSP00000288135 [100%]
KIT-002 - ENSP00000390987 [100%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human breast shows strong cytoplasmic and membranous positivity in glandular cells.
More information
 Immunohistochemical staining of human cerebellum shows moderate cytoplasmic positivity in cells in molecular layer.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:40 1:300 

Validation IH

Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data 

         Western Blot

Image

  

Description

  

Target mass (kDa)

109.9, 109.4 109.9, 109.4 

Antibody dilution

1:250 1:500 

Validation WB

Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:3000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
KIT-001
 
KIT-002