CACNA2D3

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA030849

 

Antibody HPA030850

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA030849 HPA030850 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

12 6 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

64 69 

Antigen sequence

WHSDMTAKAQKLKQTLEPCDTEYPAFVSERTIKETTGNIACEDCSKSFVI
QQIPSSNLFMVVVD
 
SCDDETVNCYLIDNNGFILVSEDYTQTGDFFGEIEGAVMNKLLTMGSFKR
ITLYDYQAMCRANKESSDG
 

Matching transcripts

CACNA2D3-001 - ENSP00000419101 [100%]
CACNA2D3-002 - ENSP00000417279 [100%]
CACNA2D3-201 - ENSP00000288197 [100%]
CACNA2D3-202 - ENSP00000389506 [100%]
 CACNA2D3-001 - ENSP00000419101 [100%]
CACNA2D3-002 - ENSP00000417279 [100%]
CACNA2D3-201 - ENSP00000288197 [100%]
CACNA2D3-202 - ENSP00000389506 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.
More information
  

Retrieval method

HIER pH6  

Antibody dilution

1:25  

Validation IH

Uncertain: Two (or more) antibodies yielding dissimilar or partly similar staining patterns and there is no available gene/protein characterization data or only limited gene/protein characterization data  

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line HeLa shows positivity in nucleus but excluded from the nucleoli.
More information
 Immunofluorescent staining of human cell line U-2 OS shows positivity in cytoplasm.
More information
 

Antibody dilution

1:4 1:34 

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available. Uncertain: The subcellular location is partly supported by literature or no literature is available. 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

123.0, 113.0 123.0, 113.0 

Antibody dilution

1:250 1:250 

Validation WB

Uncertain: No bands detected Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:500 1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
CACNA2D3-001
 
CACNA2D3-002
 
CACNA2D3-201
 
CACNA2D3-202