KCNJ15

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA016702

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA016702 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

78 

Antigen sequence

SAVCQSRTSYIPEEIYWGFEFVPVVSLSKNGKYVADFSQFEQIRKSPDCT
FYCADSEKQQLEEKYRQEDQRERELRTL
 

Matching transcripts

KCNJ15-001 - ENSP00000331698 [100%]
KCNJ15-002 - ENSP00000381911 [100%]
KCNJ15-003 - ENSP00000381905 [100%]
KCNJ15-004 - ENSP00000381904 [100%]
KCNJ15-201 - ENSP00000381907 [100%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human small intestine shows cytoplasmic and membranous positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:60 

Validation IH

Supportive: One antibody yielding a staining pattern which is consistent with gene/protein characterization data 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

42.6 

Antibody dilution

1:250 

Validation WB

Uncertain: Single band larger than predicted size in kDa (+20%) but partly supported by experimental and/or bioinformatic data 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
KCNJ15-001
 
KCNJ15-002
 
KCNJ15-003
 
KCNJ15-004
 
KCNJ15-201