CREB3L1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA024069

 

Antibody CAB026151

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 R&D Systems
 

Product name

HPA024069 AF4080 

Host species

Rabbit Goat 

Clonality

pAb msAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity 

Released in version

5 5 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein 

Length (aa)

107  

Antigen sequence

LNESDFLNNAHFPEHLDHFTENMEDFSNDLFSSFFDDPVLDEKSPLLDME
LDSPTPGIQAEHSYSLSGDSAPQSPLVPIKMEDTTQDAEHGAWALGHKLC
SIMVKQE
 
 

Matching transcripts

CREB3L1-001 - ENSP00000434939 [100%]
CREB3L1-201 - ENSP00000288400 [100%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
More information
 Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in exocrine cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:500 1:50 

Literature conformity

Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data 

RNA consistency

Not done Not done 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in cytoplasm.
More information
 Immunofluorescent staining of human cell line U-2 OS shows no positivity.
More information
 

Antibody dilution

1:400 1:13 

Validation IF

Non-supportive: The subcellular location is not consistent with literature. Uncertain: The subcellular location is partly supported by literature or no literature is available. 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY403260)
More information
  

Target mass (kDa)

57.0 57.0, 13.9, 11.3 

Antibody dilution

1:250 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:20000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
CREB3L1-001
 
CREB3L1-201