CD1A

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA010734

 

Antibody CAB000009

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 DakoCytomation
 

Product name

HPA010734 M3571 

Host species

Rabbit Mouse 

Clonality

pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Supernatant 

Released in version

3 1 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Native protein 

Length (aa)

132  

Antigen sequence

QNLVSGWLSDLQTHTWDSNSSTIVFLCPWSRGNFSNEEWKELETLFRIRT
IRSFEGIRRYAHELQFEYPFEIQVTGGCELHSGKVSGSFLQLAYQGSDFV
SFQNNSWLPYPVAGNMAKHFCKVLNQNQHEND
 
 

Matching transcripts

CD1A-001 - ENSP00000289429 [100%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human skin shows distinct positivity in Langerhans cells.
More information
 Immunohistochemical staining of human skin shows distinct positivity in Langerhans cells.
More information
 

Retrieval method

HIER pH6 HIER pH9 

Antibody dilution

1:10 1:1 

Validation IH

Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

37.1 37.1 

Antibody dilution

1:250 1:500 

Validation WB

Uncertain: No bands detected Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:500  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
CD1A-001