ZC3H18

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA040847

 

Antibody HPA041327

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA040847 HPA041327 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

8 8 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

90 70 

Antigen sequence

SRDRKSGGRLGSPKPERQRGQNSKAPAAPADRKRQLSPQSKSSSKVTSVP
GKASDPGAASTKSGKASTLSRREELLKQLKAVEDAIARKR
 
QEPDFEEKRFTVTIGEDEREFDKENEVFRDWNSRIPRDVRDTVLEPYADP
YYDYEIERFWRGGQYENFRV
 

Matching transcripts

ZC3H18-001 - ENSP00000301011 [100%]
ZC3H18-002 - ENSP00000416951 [100%]
ZC3H18-013 - ENSP00000456241 [100%]
 ZC3H18-001 - ENSP00000301011 [100%]
ZC3H18-002 - ENSP00000416951 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human stomach shows strong nuclear positivity in glandular cells.
More information
 Immunohistochemical staining of human testis shows strong nuclear positivity in cells in seminiferus ducts.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:250 1:150 

Validation IH

Supportive: Two (or more) antibodies yielding similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli.
More information
 Immunofluorescent staining of human cell line A-431 shows positivity in nucleus but not nucleoli.
More information
 

Antibody dilution

1:90 1:120 

Validation IF

Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature. 

         Western Blot

Image

  

Description

  

Target mass (kDa)

108.9, 106.4, 21.0 108.9, 106.4 

Antibody dilution

1:250 1:250 

Validation WB

Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present Non-supportive: Only bands not corresponding to the predicted size 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 1:3000 

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
ZC3H18-001
 
ZC3H18-002
 
ZC3H18-013