EDA

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA037972

 

Antibody HPA037973

 

Antibody CAB012644

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Apotech Corp.
 

Product name

HPA037972 HPA037973 ALX-804-843-C100 

Host species

Rabbit Rabbit Mouse 

Clonality

pAb pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Not known 

Released in version

12 12 4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Recombinant protein 

Length (aa)

63 82  

Antigen sequence

ELRSELRRERGAESRLGGSGTPGTSGTLSSLGGLDPDSPITSHLGQPSPK
QQPLEPGEAALHS
 
YYINFTDFASYEVVVDEKPFLQCTRSIETGKTNYNTCYTAGVCLLKARQK
IAVKMVHADISINMSKHTTFFGAIRLGEAPAS
 
 

Matching transcripts

EDA-001 - ENSP00000363681 [100%]
EDA-002 - ENSP00000363680 [100%]
EDA-007 - ENSP00000434195 [100%]
EDA-008 - ENSP00000432585 [100%]
EDA-009 - ENSP00000434861 [100%]
EDA-201 - ENSP00000340611 [100%]
 EDA-001 - ENSP00000363681 [100%]
EDA-002 - ENSP00000363680 [100%]
EDA-008 - ENSP00000432585 [100%]
  

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

  Immunohistochemical staining of human duodenum shows distinct cytoplasmic positivity in glandular cells.
More information
 

Retrieval method

  HIER pH6 

Antibody dilution

  1:125 

Validation IH

  Uncertain: One antibody yielding a staining pattern which is partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Western Blot

Image

   

Description

 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
  

Target mass (kDa)

41.3, 41.1, 40.7, 15.6, 14.0 41.3, 41.1, 40.7 41.3, 41.1, 40.7, 15.6, 14.0, 13.8 

Antibody dilution

1:250 1:250 1:500 

Validation WB

Non-supportive: Only bands not corresponding to the predicted size Uncertain: No bands detected Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present 

         Immunofluorescence

Image

   

Description

Immunofluorescent staining of human cell line HEK 293 shows positivity in vesicles.
More information
 Immunofluorescent staining of human cell line HEK 293 shows positivity in vesicles.
More information
  

Antibody dilution

1:75 1:5  

Validation IF

Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature.  

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:3000 1:500  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
EDA-001
 
EDA-002
 
EDA-007
 
EDA-008
 
EDA-009
 
EDA-201