IFNAR2

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA029229

 

Antibody CAB025889

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 R&D Systems
 

Product name

HPA029229 MAB6731 

Host species

Rabbit Mouse 

Clonality

pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

13 6 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein 

Length (aa)

73  

Antigen sequence

DEDSDDLEAPLMLSSHLEEMVDPEDPDNVQSNHLLASGEGTQPTFPSPSS
EGLWSEDAPSDQSDTSESDVDLG
 
 

Matching transcripts

IFNAR2-002 - ENSP00000343957 [100%]
IFNAR2-201 - ENSP00000371676 [100%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Application not done for this antibody. Immunohistochemical staining of human placenta shows strong membranous and cytoplasmic positivity in trophoblastic cells.
More information
 

Retrieval method

 HIER pH6 

Antibody dilution

 1:200 

Literature conformity

 Partly consistent with extensive gene/protein characterization data 

RNA consistency

 Not done 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
  

Target mass (kDa)

57.8 57.8, 37.4, 27.4, 25.8, 23.5, 22.7, 19.0, 6.3 

Antibody dilution

1:250 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Non-supportive: Only bands not corresponding to the predicted size 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line A-431 shows positivity in cytoplasm.
More information
 Application not done for this antibody. 

Antibody dilution

1:154  

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available.  

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:3000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
IFNAR2-002
 
IFNAR2-201