ACTC1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA041264

 

Antibody HPA041271

 

Antibody CAB003761

 

Antibody CAB037330

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Epitomics
 PROGEN Biotechnik
 

Product name

HPA041264 HPA041271 1184-1 61075 

Host species

Rabbit Rabbit Rabbit Mouse 

Clonality

pAb pAb mAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Supernatant Protein A/G 

Released in version

10 10 2 7 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Synthetic peptide Synthetic peptide 

Length (aa)

26 37   

Antigen sequence

PKANREKMTQIMFETFNTPAMYVAIQ
 
MVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWD
 
 
 

Matching transcripts

ACTC1-001 - ENSP00000290378 [96%]
 ACTC1-001 - ENSP00000290378 [97%]
   

Other gene match

ACTB - ENSG00000075624 [100%]
ACTA2 - ENSG00000107796 [96%]
ACTA1 - ENSG00000143632 [96%]
ACTG2 - ENSG00000163017 [96%]
ACTBL2 - ENSG00000169067 [92%]
ACTG1 - ENSG00000184009 [100%]
POTEE - ENSG00000188219 [100%]
POTEF - ENSG00000196604 [100%]
POTEI - ENSG00000196834 [100%]
POTEJ - ENSG00000222038 [100%]
 ACTB - ENSG00000075624 [100%]
ACTA2 - ENSG00000107796 [97%]
ACTA1 - ENSG00000143632 [97%]
ACTG2 - ENSG00000163017 [97%]
ACTBL2 - ENSG00000169067 [92%]
ACTG1 - ENSG00000184009 [100%]
POTEE - ENSG00000188219 [84%]
POTEF - ENSG00000196604 [84%]
POTEI - ENSG00000196834 [84%]
POTEJ - ENSG00000222038 [84%]
   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

    

Description

Immunohistochemical staining of human stomach, upper shows strong membranous positivity in glandular cells.
More information
 Immunohistochemical staining of human stomach, upper shows strong membranous positivity in glandular cells.
More information
 Immunohistochemical staining of human smooth muscle shows strong cytoplasmic positivity in smooth muscle cells.
More information
 Immunohistochemical staining of human heart muscle shows strong cytoplasmic and membranous positivity in myocytes.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:1800 1:150 1:150 1:600 

Literature conformity

Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data 

RNA consistency

Not done Not done Not done Not done 

         Western Blot

Image

    

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
  Lane 1: Marker [kDa] 230, 110, 82, 49.3, 32.2, 25.5, 17.6
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: A-431
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

121.4, 121.3, 117.4, 42.1, 42.0, 41.9, 41.8, 41.7, 37.1, 26.9, 23.8, 18.0, 16.8 121.4, 121.3, 117.4, 42.1, 42.0, 41.9, 41.8, 41.7, 32.3, 26.9, 23.8, 21.8, 18.0, 16.8, 16.3, 14.5, 13.9, 13.0, 11.4, 11.0, 8.5 42.0 42.0 

Antibody dilution

1:250 1:250 1:500 1:500 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

    

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. Application not done for this antibody. 

Antibody dilution

1:3000 1:3000   

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). Supportive: Pass with single peak corresponding to interaction only with its own antigen.   
 

ANTIGEN VIEW

? »
 
 
 
ACTC1-001