ACE

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA029298

 

Antibody CAB002426

 

Antibody CAB002921

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Novocastra
 Chemicon
 

Product name

HPA029298 NCL-CD143-510 MAB3500 

Host species

Rabbit Mouse Mouse 

Clonality

pAb mAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Not known Not known 

Released in version

9 1 1 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Not known Not known 

Length (aa)

138   

Antigen sequence

KFVEEYDRTSQVVWNEYAEANWNYNTNITTETSKILLQKNMQIANHTLKY
GTQARKFDVNQLQNTTIKRIIKKVQDLERAALPAQELEEYNKILLDMETT
YSVATVCHPNGSCLQLEPDLTNVMATSRKYEDLLWAWE
 
 
 

Matching transcripts

ACE-001 - ENSP00000290866 [100%]
ACE-007 - ENSP00000290863 [100%]
ACE-009 - ENSP00000392247 [100%]
ACE-202 - ENSP00000397593 [100%]
ACE-203 - ENSP00000464539 [100%]
ACE-006 - ENSP00000462599 [86%]
   

Other gene match

ACE - ENSG00000264813 [100%]
   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human kidney shows strong membranous positivity in cells in tubules.
More information
 Immunohistochemical staining of human duodenum shows strong membranous and cytoplasmic positivity in glandular cells.
More information
 Immunohistochemical staining of human kidney shows strong membranous positivity in cells in tubules.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:70 1:100 1:500 

Validation IH

Uncertain: The multi-targeting antibody yielding a staining pattern consistent with gene/protein characterization data for at least one of the genes whereas any of the other genes has no available gene/protein characterization data or is contradicted by gene/protein Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data 

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
  

Target mass (kDa)

149.7, 131.7, 84.0, 83.3, 78.7, 23.1 149.7, 131.7, 84.0, 83.3, 78.7, 58.5, 53.8, 35.5, 33.0, 23.1, 18.1, 15.7, 15.4, 13.0, 12.4, 4.5, 3.9 149.7, 131.7, 84.0, 83.3, 78.7, 58.5, 53.8, 35.5, 33.0, 23.1, 18.1, 15.7, 15.4, 13.0, 12.4, 4.5, 3.9 

Antibody dilution

1:250 1:500 1:500 

Validation WB

Uncertain: No bands detected Uncertain: No bands detected Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
   

Antibody dilution

1:3000   

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%).   
 

ANTIGEN VIEW

? »
 
 
 
ACE-001
 
ACE-006
 
ACE-007
 
ACE-009
 
ACE-202
 
ACE-203